Lineage for d1l9bh1 (1l9b H:36-253)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 167245Fold b.41: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50345] (1 superfamily)
  4. 167246Superfamily b.41.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50346] (1 family) (S)
  5. 167247Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)
  6. 167248Protein Photosynthetic reaction centre [50348] (3 species)
  7. 167249Species Rhodobacter sphaeroides [TaxId:1063] [50350] (28 PDB entries)
  8. 167254Domain d1l9bh1: 1l9b H:36-253 [73712]
    Other proteins in same PDB: d1l9bc_, d1l9bh2, d1l9bl1, d1l9bm1

Details for d1l9bh1

PDB Entry: 1l9b (more details), 2.4 Å

PDB Description: X-Ray Structure of the Cytochrome-c(2)-Photosynthetic Reaction Center Electron Transfer Complex from Rhodobacter sphaeroides in Type II Co-Crystals

SCOP Domain Sequences for d1l9bh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l9bh1 b.41.1.1 (H:36-253) Photosynthetic reaction centre {Rhodobacter sphaeroides}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksvva

SCOP Domain Coordinates for d1l9bh1:

Click to download the PDB-style file with coordinates for d1l9bh1.
(The format of our PDB-style files is described here.)

Timeline for d1l9bh1: