Lineage for d1l8rb_ (1l8r B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2309714Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
    core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
  4. 2309715Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) (S)
  5. 2309781Family a.6.1.4: Dachshund-homology domain [74693] (3 proteins)
    Pfam PF02437
  6. 2309782Protein Retinal determination protein Dachshund [74694] (1 species)
  7. 2309783Species Human (Homo sapiens) [TaxId:9606] [74695] (1 PDB entry)
  8. 2309785Domain d1l8rb_: 1l8r B: [73701]
    Other proteins in same PDB: d1l8ra2

Details for d1l8rb_

PDB Entry: 1l8r (more details), 1.65 Å

PDB Description: Structure of the Retinal Determination Protein Dachshund Reveals a DNA-Binding Motif
PDB Compounds: (B:) Dachshund

SCOPe Domain Sequences for d1l8rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l8rb_ a.6.1.4 (B:) Retinal determination protein Dachshund {Human (Homo sapiens) [TaxId: 9606]}
qnneckmvdlrgakvasftvegceliclpqafdlflkhlvgglhtvytklkrleitpvvc
nveqvrilrglgaiqpgvnrcklisrkdfetlyndctna

SCOPe Domain Coordinates for d1l8rb_:

Click to download the PDB-style file with coordinates for d1l8rb_.
(The format of our PDB-style files is described here.)

Timeline for d1l8rb_: