![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.6: Putative DNA-binding domain [46954] (1 superfamily) core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different |
![]() | Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) ![]() |
![]() | Family a.6.1.4: Dachshund-homology domain [74693] (3 proteins) Pfam PF02437 |
![]() | Protein Retinal determination protein Dachshund [74694] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [74695] (1 PDB entry) |
![]() | Domain d1l8rb_: 1l8r B: [73701] Other proteins in same PDB: d1l8ra2 |
PDB Entry: 1l8r (more details), 1.65 Å
SCOPe Domain Sequences for d1l8rb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l8rb_ a.6.1.4 (B:) Retinal determination protein Dachshund {Human (Homo sapiens) [TaxId: 9606]} qnneckmvdlrgakvasftvegceliclpqafdlflkhlvgglhtvytklkrleitpvvc nveqvrilrglgaiqpgvnrcklisrkdfetlyndctna
Timeline for d1l8rb_: