SCOPe 2.08: Domain d1l7vc_: 1l7v C:

Lineage for d1l7vc_ (1l7v C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology
   missing some secondary structures that made up less than one-third of the common domain
   

6. Protein ABC transporter involved in vitamin B12 uptake, BtuD [75209] (1 species)

7. Species Escherichia coli [TaxId:562] [75210] (2 PDB entries)

8. Domain d1l7vc_: 1l7v C: [73674]
   Other proteins in same PDB: d1l7va_, d1l7vb_
   complexed with v4o

Details for d1l7vc_

PDB Entry: 1l7v, 3.2 Å

PDB Description: Bacterial ABC Transporter Involved in B12 Uptake

PDB Compounds: (C:) Vitamin B12 transport ATP-binding protein btuD

SCOPe Domain Sequences for d1l7vc_:

Sequence; same for both SEQRES and ATOM records:

>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]}
sivmqlqdvaestrlgplsgevrageilhlvgpngagkstllarmagmtsgkgsiqfagq
pleawsatklalhraylsqqqtppfatpvwhyltlhqhdktrtellndvagalalddklg
rstnqlsggewqrvrlaavvlqitpqanpagqlllldepmnsldvaqqsaldkilsalcq
qglaivmsshdlnhtlrhahrawllkggkmlasgrreevltppnlaqaygm

Timeline for d1l7vc_:

• d1l7vc_ first appeared in SCOP 1.61
  
• d1l7vc_ appears in SCOPe 2.07