Lineage for d1l6wf_ (1l6w F:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 235645Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 237126Superfamily c.1.10: Aldolase [51569] (4 families) (S)
    Common fold covers whole protein structure
  5. 237127Family c.1.10.1: Class I aldolase [51570] (8 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 237219Protein Fructose-6-phosphate aldolase [75085] (1 species)
  7. 237220Species Escherichia coli [TaxId:562] [75086] (1 PDB entry)
  8. 237226Domain d1l6wf_: 1l6w F: [73637]

Details for d1l6wf_

PDB Entry: 1l6w (more details), 1.93 Å

PDB Description: fructose-6-phosphate aldolase

SCOP Domain Sequences for d1l6wf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l6wf_ c.1.10.1 (F:) Fructose-6-phosphate aldolase {Escherichia coli}
melyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqgrlfaqv
mattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavygaaqglls
alagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqaldcllag
cesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi

SCOP Domain Coordinates for d1l6wf_:

Click to download the PDB-style file with coordinates for d1l6wf_.
(The format of our PDB-style files is described here.)

Timeline for d1l6wf_: