Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (4 families) Common fold covers whole protein structure |
Family c.1.10.1: Class I aldolase [51570] (8 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
Protein Fructose-6-phosphate aldolase [75085] (1 species) |
Species Escherichia coli [TaxId:562] [75086] (1 PDB entry) |
Domain d1l6we_: 1l6w E: [73636] |
PDB Entry: 1l6w (more details), 1.93 Å
SCOP Domain Sequences for d1l6we_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l6we_ c.1.10.1 (E:) Fructose-6-phosphate aldolase {Escherichia coli} melyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqgrlfaqv mattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavygaaqglls alagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqaldcllag cesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi
Timeline for d1l6we_: