Lineage for d1l5ja1 (1l5j A:1-160)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2340426Superfamily a.118.15: Aconitase B, N-terminal domain [74778] (1 family) (S)
    automatically mapped to Pfam PF11791
  5. 2340427Family a.118.15.1: Aconitase B, N-terminal domain [74779] (1 protein)
  6. 2340428Protein Aconitase B, N-terminal domain [74780] (1 species)
  7. 2340429Species Escherichia coli [TaxId:562] [74781] (1 PDB entry)
  8. 2340430Domain d1l5ja1: 1l5j A:1-160 [73592]
    Other proteins in same PDB: d1l5ja2, d1l5ja3, d1l5jb2, d1l5jb3
    complexed with f3s, tra

Details for d1l5ja1

PDB Entry: 1l5j (more details), 2.4 Å

PDB Description: crystal structure of e. coli aconitase b.
PDB Compounds: (A:) Aconitate hydratase 2

SCOPe Domain Sequences for d1l5ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l5ja1 a.118.15.1 (A:1-160) Aconitase B, N-terminal domain {Escherichia coli [TaxId: 562]}
mleeyrkhvaeraaegiapkpldanqmaalvellknppageeeflldlltnrvppgvdea
ayvkagflaaiakgeaksplltpekaiellgtmqggynihplidalddaklapiaakals
htllmfdnfydveekakagneyakqvmqswadaewflnrp

SCOPe Domain Coordinates for d1l5ja1:

Click to download the PDB-style file with coordinates for d1l5ja1.
(The format of our PDB-style files is described here.)

Timeline for d1l5ja1: