Lineage for d1l5ja2 (1l5j A:161-372)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2459236Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 2459284Superfamily c.8.2: LeuD/IlvD-like [52016] (4 families) (S)
    contains mixed beta-sheet barrel, closed n=7, S=10
  5. 2459285Family c.8.2.1: LeuD-like [52017] (4 proteins)
    Pfam PF00694; permutation of the domain order in the proteins containing this family domain
  6. 2459304Protein Aconitase B, second N-terminal domain [75135] (1 species)
  7. 2459305Species Escherichia coli [TaxId:562] [75136] (1 PDB entry)
  8. 2459306Domain d1l5ja2: 1l5j A:161-372 [73593]
    Other proteins in same PDB: d1l5ja1, d1l5ja3, d1l5jb1, d1l5jb3
    complexed with f3s, tra

Details for d1l5ja2

PDB Entry: 1l5j (more details), 2.4 Å

PDB Description: crystal structure of e. coli aconitase b.
PDB Compounds: (A:) Aconitate hydratase 2

SCOPe Domain Sequences for d1l5ja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l5ja2 c.8.2.1 (A:161-372) Aconitase B, second N-terminal domain {Escherichia coli [TaxId: 562]}
alaekltvtvfkvtgetntddlspapdawsrpdiplhalamlknaregiepdqpgvvgpi
kqiealqqkgfplayvgdvvgtgssrksatnsvlwfmgddiphvpnkrggglclggkiap
iffntmedagalpievdvsnlnmgdvidvypykgevrnhetgellatfelktdvlidevr
aggripliigrglttkarealglphsdvfrqa

SCOPe Domain Coordinates for d1l5ja2:

Click to download the PDB-style file with coordinates for d1l5ja2.
(The format of our PDB-style files is described here.)

Timeline for d1l5ja2: