![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
![]() | Superfamily c.8.2: LeuD/IlvD-like [52016] (4 families) ![]() contains mixed beta-sheet barrel, closed n=7, S=10 |
![]() | Family c.8.2.1: LeuD-like [52017] (4 proteins) Pfam PF00694; permutation of the domain order in the proteins containing this family domain |
![]() | Protein Aconitase B, second N-terminal domain [75135] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [75136] (1 PDB entry) |
![]() | Domain d1l5ja2: 1l5j A:161-372 [73593] Other proteins in same PDB: d1l5ja1, d1l5ja3, d1l5jb1, d1l5jb3 complexed with f3s, tra |
PDB Entry: 1l5j (more details), 2.4 Å
SCOPe Domain Sequences for d1l5ja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l5ja2 c.8.2.1 (A:161-372) Aconitase B, second N-terminal domain {Escherichia coli [TaxId: 562]} alaekltvtvfkvtgetntddlspapdawsrpdiplhalamlknaregiepdqpgvvgpi kqiealqqkgfplayvgdvvgtgssrksatnsvlwfmgddiphvpnkrggglclggkiap iffntmedagalpievdvsnlnmgdvidvypykgevrnhetgellatfelktdvlidevr aggripliigrglttkarealglphsdvfrqa
Timeline for d1l5ja2: