Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.15: Integrin domains [69179] (2 families) |
Family b.1.15.1: Integrin domains [69180] (2 proteins) |
Protein Thigh, calf-1 and calf-2 domains of integrin alpha [69181] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [69182] (4 PDB entries) Uniprot P06756 31-986 |
Domain d1l5ga1: 1l5g A:439-598 [73581] Other proteins in same PDB: d1l5ga4, d1l5gb1, d1l5gb2, d1l5gb3, d1l5gb4, d1l5gb5 complexed with mn, nag |
PDB Entry: 1l5g (more details), 3.2 Å
SCOPe Domain Sequences for d1l5ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l5ga1 b.1.15.1 (A:439-598) Thigh, calf-1 and calf-2 domains of integrin alpha {Human (Homo sapiens) [TaxId: 9606]} pvitvnaglevypsilnqdnktcslpgtalkvscfnvrfclkadgkgvlprklnfqvell ldklkqkgairralflysrspshsknmtisrgglmqceeliaylrdesefrdkltpitif meyrldyrtaadttglqpilnqftpanisrqahilldcge
Timeline for d1l5ga1: