SCOPe 2.07: Domain d1l5gb3: 1l5g B:606-690

Lineage for d1l5gb3 (1l5g B:606-690)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.200: Integrin beta tail domain [69686] (1 superfamily)
   alpha-beta-loop-beta(3); loop across free side of beta-sheet

4. Superfamily d.200.1: Integrin beta tail domain [69687] (1 family)
   automatically mapped to Pfam PF07965

5. Family d.200.1.1: Integrin beta tail domain [69688] (1 protein)

6. Protein Integrin beta tail domain [69689] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69690] (4 PDB entries)
   Uniprot P05106 27-716

8. Domain d1l5gb3: 1l5g B:606-690 [73587]
   Other proteins in same PDB: d1l5ga1, d1l5ga2, d1l5ga3, d1l5ga4, d1l5gb1, d1l5gb2, d1l5gb4, d1l5gb5
   complexed with mn, nag

Details for d1l5gb3

PDB Entry: 1l5g, 3.2 Å

PDB Description: crystal structure of the extracellular segment of integrin avb3 in complex with an arg-gly-asp ligand

PDB Compounds: (B:) integrin beta-3

SCOPe Domain Sequences for d1l5gb3:

Sequence; same for both SEQRES and ATOM records:

>d1l5gb3 d.200.1.1 (B:606-690) Integrin beta tail domain {Human (Homo sapiens) [TaxId: 9606]}
dactfkkecveckkfdrepymtentcnrycrdeiesvkelkdtgkdavnctykneddcvv
rfqyyedssgksilyvveepecpkg

Timeline for d1l5gb3:

• d1l5gb3 first appeared in SCOP 1.61
  
• d1l5gb3 appears in SCOPe 2.06
  
• d1l5gb3 appears in the current release, SCOPe 2.08