SCOP 1.63: Domain d1l4ib2: 1l4i B:121-206

Lineage for d1l4ib2 (1l4i B:121-206)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.7: C2 domain-like [49561] (4 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (1 family)

5. Family b.7.2.1: Periplasmic chaperone C-domain [49585] (3 proteins)

6. Protein SfaE [74881] (1 species)

7. Species Escherichia coli [TaxId:562] [74882] (1 PDB entry)

8. Domain d1l4ib2: 1l4i B:121-206 [73567]
   Other proteins in same PDB: d1l4ia1, d1l4ib1

Details for d1l4ib2

PDB Entry: 1l4i, 2.2 Å

PDB Description: Crystal Structure of the Periplasmic Chaperone SfaE

SCOP Domain Sequences for d1l4ib2:

Sequence, based on SEQRES records:

>d1l4ib2 b.7.2.1 (B:121-206) SfaE {Escherichia coli}
vippeqapgkleftrenggltlfnptpyyltvtdlkagnkslentmvppqgkvtvnipgg
ytggdityktindygalteqvrgvvk

Sequence, based on observed residues (ATOM records):

>d1l4ib2 b.7.2.1 (B:121-206) SfaE {Escherichia coli}
vippeqapgkleftreltlfnptpyyltvtdlkagnkslentmvppqgkvtvnipggdit
yktindygalteqvrgvvk

Timeline for d1l4ib2:

• d1l4ib2 first appeared in SCOP 1.61
  
• d1l4ib2 appears in SCOP 1.65
  
• d1l4ib2 appears in the current release, SCOPe 2.08