Lineage for d1l0oc_ (1l0o C:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 216884Fold a.112: RNA polymerase sigma subunit [48328] (1 superfamily)
    multihelical; consists of several all-alpha subdomains
  4. 216885Superfamily a.112.1: RNA polymerase sigma subunit [48329] (1 family) (S)
  5. 216886Family a.112.1.1: RNA polymerase sigma subunit [48330] (4 proteins)
  6. 216904Protein SigmaF fragment [74769] (1 species)
  7. 216905Species Bacillus stearothermophilus [TaxId:1422] [74770] (1 PDB entry)
  8. 216906Domain d1l0oc_: 1l0o C: [73405]
    Other proteins in same PDB: d1l0oa_, d1l0ob_
    complexed with adp, mg; mutant

Details for d1l0oc_

PDB Entry: 1l0o (more details), 2.9 Å

PDB Description: crystal structure of the bacillus stearothermophilus anti-sigma factor spoiiab with the sporulation sigma factor sigmaf

SCOP Domain Sequences for d1l0oc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0oc_ a.112.1.1 (C:) SigmaF fragment {Bacillus stearothermophilus}
dgtvkvsrslkemgnkirkakdelsktrgraptvteiadhlgispedvvlaqeavrl

SCOP Domain Coordinates for d1l0oc_:

Click to download the PDB-style file with coordinates for d1l0oc_.
(The format of our PDB-style files is described here.)

Timeline for d1l0oc_: