| Class a: All alpha proteins [46456] (171 folds) |
| Fold a.112: RNA polymerase sigma subunit [48328] (1 superfamily) multihelical; consists of several all-alpha subdomains |
Superfamily a.112.1: RNA polymerase sigma subunit [48329] (1 family) ![]() |
| Family a.112.1.1: RNA polymerase sigma subunit [48330] (4 proteins) |
| Protein SigmaF fragment [74769] (1 species) |
| Species Bacillus stearothermophilus [TaxId:1422] [74770] (1 PDB entry) |
| Domain d1l0oc_: 1l0o C: [73405] Other proteins in same PDB: d1l0oa_, d1l0ob_ complexed with adp, mg; mutant |
PDB Entry: 1l0o (more details), 2.9 Å
SCOP Domain Sequences for d1l0oc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l0oc_ a.112.1.1 (C:) SigmaF fragment {Bacillus stearothermophilus}
dgtvkvsrslkemgnkirkakdelsktrgraptvteiadhlgispedvvlaqeavrl
Timeline for d1l0oc_: