SCOPe 2.07: Domain d1kzc1_: 1kzc 1:

Lineage for d1kzc1_ (1kzc 1:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Mannose-binding protein A, C-lectin domain [56458] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)

8. Domain d1kzc1_: 1kzc 1: [73348]
   complexed with ca, cl, man

Details for d1kzc1_

PDB Entry: 1kzc, 1.85 Å

PDB Description: complex of mbp-c and high-affinity linear trimannose

PDB Compounds: (1:) mannose-binding protein c

SCOPe Domain Sequences for d1kzc1_:

Sequence; same for both SEQRES and ATOM records:

>d1kzc1_ d.169.1.1 (1:) Mannose-binding protein A, C-lectin domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgitdqrtenvfe
dltgnrvrytnwnegepnnvgsgencvvlltngkwndvpcsdsflvvcefs

Timeline for d1kzc1_:

• d1kzc1_ first appeared in SCOP 1.61
  
• d1kzc1_ appears in SCOPe 2.06
  
• d1kzc1_ appears in the current release, SCOPe 2.08