Lineage for d1kzc1_ (1kzc 1:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 198738Fold d.169: C-type lectin-like [56435] (1 superfamily)
  4. 198739Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 198740Family d.169.1.1: C-type lectin domain [56437] (18 proteins)
  6. 198806Protein Mannose-binding protein A, lectin domain [56458] (2 species)
  7. 198809Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)
  8. 198854Domain d1kzc1_: 1kzc 1: [73348]

Details for d1kzc1_

PDB Entry: 1kzc (more details), 1.85 Å

PDB Description: complex of mbp-c and high-affinity linear trimannose

SCOP Domain Sequences for d1kzc1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kzc1_ d.169.1.1 (1:) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
kyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgitdqrtenvfe
dltgnrvrytnwnegepnnvgsgencvvlltngkwndvpcsdsflvvcefs

SCOP Domain Coordinates for d1kzc1_:

Click to download the PDB-style file with coordinates for d1kzc1_.
(The format of our PDB-style files is described here.)

Timeline for d1kzc1_: