Lineage for d1kzc1_ (1kzc 1:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1048063Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1048064Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1048065Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1048173Protein Mannose-binding protein A, C-lectin domain [56458] (2 species)
  7. 1048176Species Norway rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)
  8. 1048223Domain d1kzc1_: 1kzc 1: [73348]
    complexed with ca, cl, man

Details for d1kzc1_

PDB Entry: 1kzc (more details), 1.85 Å

PDB Description: complex of mbp-c and high-affinity linear trimannose
PDB Compounds: (1:) mannose-binding protein c

SCOPe Domain Sequences for d1kzc1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kzc1_ d.169.1.1 (1:) Mannose-binding protein A, C-lectin domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgitdqrtenvfe
dltgnrvrytnwnegepnnvgsgencvvlltngkwndvpcsdsflvvcefs

SCOPe Domain Coordinates for d1kzc1_:

Click to download the PDB-style file with coordinates for d1kzc1_.
(The format of our PDB-style files is described here.)

Timeline for d1kzc1_: