Lineage for d1kzb1_ (1kzb 1:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 264459Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 264460Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 264461Family d.169.1.1: C-type lectin domain [56437] (18 proteins)
  6. 264527Protein Mannose-binding protein A, lectin domain [56458] (2 species)
  7. 264530Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)
  8. 264557Domain d1kzb1_: 1kzb 1: [73346]

Details for d1kzb1_

PDB Entry: 1kzb (more details), 1.8 Å

PDB Description: complex of mbp-c and trimannosyl core

SCOP Domain Sequences for d1kzb1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kzb1_ d.169.1.1 (1:) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
kyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgitdqrtenvfe
dltgnrvrytnwnegepnnvgsgencvvlltngkwndvpcsdsflvvcefs

SCOP Domain Coordinates for d1kzb1_:

Click to download the PDB-style file with coordinates for d1kzb1_.
(The format of our PDB-style files is described here.)

Timeline for d1kzb1_: