Lineage for d1kz7c2 (1kz7 C:1819-1960)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 467364Fold b.55: PH domain-like [50728] (1 superfamily)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 467365Superfamily b.55.1: PH domain-like [50729] (9 families) (S)
  5. 467366Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (24 proteins)
  6. 467381Protein Dbl's big sister, Dbs [74989] (1 species)
  7. 467382Species Mouse (Mus musculus) [TaxId:10090] [74990] (4 PDB entries)
  8. 467384Domain d1kz7c2: 1kz7 C:1819-1960 [73337]
    Other proteins in same PDB: d1kz7a1, d1kz7b_, d1kz7c1, d1kz7d_

Details for d1kz7c2

PDB Entry: 1kz7 (more details), 2.4 Å

PDB Description: crystal structure of the dh/ph fragment of murine dbs in complex with the placental isoform of human cdc42

SCOP Domain Sequences for d1kz7c2:

Sequence, based on SEQRES records: (download)

>d1kz7c2 b.55.1.1 (C:1819-1960) Dbl's big sister, Dbs {Mouse (Mus musculus)}
tgydgnlgdlgkllmqgsfsvwtdhkkghtkvkelarfkpmqrhlflhekavlfckkree
ngegyekapsysykqslnmtavgitenvkgdtkkfeiwynareevyiiqaptpeikaawv
nairkvltsqlqacreasqhra

Sequence, based on observed residues (ATOM records): (download)

>d1kz7c2 b.55.1.1 (C:1819-1960) Dbl's big sister, Dbs {Mouse (Mus musculus)}
tgydgnlgdlgkllmqgsfsvwtdhkelarfkpmqrhlflhekavlfckkreengegyek
apsysykqslnmtavgitenvkgdtkkfeiwynareevyiiqaptpeikaawvnairkvl
tsqlqacreasqhra

SCOP Domain Coordinates for d1kz7c2:

Click to download the PDB-style file with coordinates for d1kz7c2.
(The format of our PDB-style files is described here.)

Timeline for d1kz7c2: