SCOPe 2.08: Domain d1kz7c2: 1kz7 C:1819-1960

Lineage for d1kz7c2 (1kz7 C:1819-1960)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
   Pfam PF00169

6. Protein Dbl's big sister, Dbs [74989] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [74990] (4 PDB entries)
   SQ Q64096 624-958 # 98% sequence identity; the rat sequence Q63406 region 499-833 is 100% identical to the PDB sequence

8. Domain d1kz7c2: 1kz7 C:1819-1960 [73337]
   Other proteins in same PDB: d1kz7a1, d1kz7b_, d1kz7c1, d1kz7d_

Details for d1kz7c2

PDB Entry: 1kz7, 2.4 Å

PDB Description: crystal structure of the dh/ph fragment of murine dbs in complex with the placental isoform of human cdc42

PDB Compounds: (C:) guanine nucleotide exchange factor dbs

SCOPe Domain Sequences for d1kz7c2:

Sequence, based on SEQRES records:

>d1kz7c2 b.55.1.1 (C:1819-1960) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]}
tgydgnlgdlgkllmqgsfsvwtdhkkghtkvkelarfkpmqrhlflhekavlfckkree
ngegyekapsysykqslnmtavgitenvkgdtkkfeiwynareevyiiqaptpeikaawv
nairkvltsqlqacreasqhra

Sequence, based on observed residues (ATOM records):

>d1kz7c2 b.55.1.1 (C:1819-1960) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]}
tgydgnlgdlgkllmqgsfsvwtdhkelarfkpmqrhlflhekavlfckkreengegyek
apsysykqslnmtavgitenvkgdtkkfeiwynareevyiiqaptpeikaawvnairkvl
tsqlqacreasqhra

Timeline for d1kz7c2:

• d1kz7c2 first appeared in SCOP 1.61
  
• d1kz7c2 appears in SCOPe 2.07