Lineage for d1kywa2 (1kyw A:120-362)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 399355Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 399356Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (38 families) (S)
  5. 399461Family c.66.1.12: Plant O-methyltransferase, C-terminal domain [64111] (4 proteins)
  6. 399466Protein Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase [75259] (1 species)
  7. 399467Species Alfalfa (Medicago sativa) [TaxId:3879] [75260] (2 PDB entries)
  8. 399471Domain d1kywa2: 1kyw A:120-362 [73297]
    Other proteins in same PDB: d1kywa1, d1kywc1, d1kywf1

Details for d1kywa2

PDB Entry: 1kyw (more details), 2.4 Å

PDB Description: Crystal Structure Analysis of Caffeic Acid/5-hydroxyferulic acid 3/5-O-methyltransferase in complex with 5-hydroxyconiferaldehyde

SCOP Domain Sequences for d1kywa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kywa2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa)}
dgvsisalnlmnqdkvlmeswyhlkdavldggipfnkaygmtafeyhgtdprfnkvfnkg
msdhstitmkkiletytgfeglkslvdvgggtgavintivskyptikginfdlphvieda
psypgvehvggdmfvsipkadavfmkwichdwsdehclkflkncyealpdngkvivaeci
lpvapdsslatkgvvhidvimlahnpggkertqkefedlakgagfqgfkvhcnafntyim
efl

SCOP Domain Coordinates for d1kywa2:

Click to download the PDB-style file with coordinates for d1kywa2.
(The format of our PDB-style files is described here.)

Timeline for d1kywa2: