Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (38 families) |
Family c.66.1.12: Plant O-methyltransferase, C-terminal domain [64111] (4 proteins) |
Protein Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase [75259] (1 species) |
Species Alfalfa (Medicago sativa) [TaxId:3879] [75260] (2 PDB entries) |
Domain d1kywc2: 1kyw C:120-365 [73299] Other proteins in same PDB: d1kywa1, d1kywc1, d1kywf1 |
PDB Entry: 1kyw (more details), 2.4 Å
SCOP Domain Sequences for d1kywc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kywc2 c.66.1.12 (C:120-365) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa)} dgvsisalnlmnqdkvlmeswyhlkdavldggipfnkaygmtafeyhgtdprfnkvfnkg msdhstitmkkiletytgfeglkslvdvgggtgavintivskyptikginfdlphvieda psypgvehvggdmfvsipkadavfmkwichdwsdehclkflkncyealpdngkvivaeci lpvapdsslatkgvvhidvimlahnpggkertqkefedlakgagfqgfkvhcnafntyim eflkkv
Timeline for d1kywc2:
View in 3D Domains from other chains: (mouse over for more information) d1kywa1, d1kywa2, d1kywf1, d1kywf2 |