![]() | Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (30 families) ![]() |
![]() | Family c.66.1.12: Plant O-methyltransferase, C-terminal domain [64111] (3 proteins) |
![]() | Protein Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase [75259] (1 species) |
![]() | Species Alfalfa (Medicago sativa) [TaxId:3879] [75260] (2 PDB entries) |
![]() | Domain d1kywa2: 1kyw A:120-362 [73297] Other proteins in same PDB: d1kywa1, d1kywc1, d1kywf1 |
PDB Entry: 1kyw (more details), 2.4 Å
SCOP Domain Sequences for d1kywa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kywa2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa)} dgvsisalnlmnqdkvlmeswyhlkdavldggipfnkaygmtafeyhgtdprfnkvfnkg msdhstitmkkiletytgfeglkslvdvgggtgavintivskyptikginfdlphvieda psypgvehvggdmfvsipkadavfmkwichdwsdehclkflkncyealpdngkvivaeci lpvapdsslatkgvvhidvimlahnpggkertqkefedlakgagfqgfkvhcnafntyim efl
Timeline for d1kywa2:
![]() Domains from other chains: (mouse over for more information) d1kywc1, d1kywc2, d1kywf1, d1kywf2 |