Lineage for d1ky9b3 (1ky9 B:11-259)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055631Family b.47.1.1: Prokaryotic proteases [50495] (16 protein domains)
  6. 2055738Protein Protease Do (DegP, HtrA), catalytic domain [74969] (2 species)
  7. 2055739Species Escherichia coli [TaxId:562] [74970] (4 PDB entries)
  8. 2055742Domain d1ky9b3: 1ky9 B:11-259 [73202]
    Other proteins in same PDB: d1ky9a1, d1ky9b1, d1ky9b2

Details for d1ky9b3

PDB Entry: 1ky9 (more details), 2.8 Å

PDB Description: Crystal Structure of DegP (HtrA)
PDB Compounds: (B:) Protease do

SCOPe Domain Sequences for d1ky9b3:

Sequence, based on SEQRES records: (download)

>d1ky9b3 b.47.1.1 (B:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]}
qmpslapmlekvmpsvvsinvegsttvntprmprnfqqffgddspfcqegspfqsspfcq
ggqggngggqqqkfmalgsgviidadkgyvvtnnhvvdnatvikvqlsdgrkfdakmvgk
dprsdialiqiqnpknltaikmadsdalrvgdytvaignpfglgetvtsgivsalgrsgl
naenyenfiqtdaainrgnaggalvnlngeligintailapdggnigigfaipsnmvknl
tsqmveygq

Sequence, based on observed residues (ATOM records): (download)

>d1ky9b3 b.47.1.1 (B:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]}
qmpslapmlekvmpsvvsinvegsttvntprmprnfqqffggqqqkfmalgsgviidadk
gyvvtnnhvvdnatvikvqlsdgrkfdakmvgkdprsdialiqiqnpknltaikmadsda
lrvgdytvaignpfglgetvtsgivsalgrenfiqtdaainrgnaggalvnlngeligin
tailapdggnigigfaipsnmvknltsqmveygq

SCOPe Domain Coordinates for d1ky9b3:

Click to download the PDB-style file with coordinates for d1ky9b3.
(The format of our PDB-style files is described here.)

Timeline for d1ky9b3: