SCOPe 2.08: Domain d1ky9a1: 1ky9 A:260-353

Lineage for d1ky9a1 (1ky9 A:260-353)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.4: HtrA-like serine proteases [74933] (4 proteins)

6. Protein Protease Do (DegP, HtrA), C-terminal domains [74934] (1 species)
   duplication: tandem repeat of two PDZ domains

7. Species Escherichia coli [TaxId:562] [74935] (5 PDB entries)

8. Domain d1ky9a1: 1ky9 A:260-353 [73198]
   Other proteins in same PDB: d1ky9a2, d1ky9b3

Details for d1ky9a1

PDB Entry: 1ky9, 2.8 Å

PDB Description: crystal structure of degp (htra)

PDB Compounds: (A:) Protease do

SCOPe Domain Sequences for d1ky9a1:

Sequence; same for both SEQRES and ATOM records:

>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]}
vkrgelgimgtelnselakamkvdaqrgafvsqvlpnssaakagikagdvitslngkpis
sfaalraqvgtmpvgskltlgllrdgkqvnvnle

Timeline for d1ky9a1:

• d1ky9a1 first appeared in SCOP 1.61
  
• d1ky9a1 appears in SCOPe 2.07