Lineage for d1ky9b2 (1ky9 B:359-446)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 165991Fold b.36: PDZ domain-like [50155] (1 superfamily)
  4. 165992Superfamily b.36.1: PDZ domain-like [50156] (4 families) (S)
  5. 166052Family b.36.1.4: HtrA-like serine proteases [74933] (2 proteins)
  6. 166056Protein Protease Do (DegP, HtrA), C-terminal domains [74934] (1 species)
  7. 166057Species Escherichia coli [TaxId:562] [74935] (1 PDB entry)
  8. 166060Domain d1ky9b2: 1ky9 B:359-446 [73201]
    Other proteins in same PDB: d1ky9a2, d1ky9b3

Details for d1ky9b2

PDB Entry: 1ky9 (more details), 2.8 Å

PDB Description: Crystal Structure of DegP (HtrA)
PDB Compounds: (B:)

SCOP Domain Sequences for d1ky9b2:

Sequence, based on SEQRES records: (download)

>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli}
qnqvdsssifngiegaemsnkgkdqgvvvnnvktgtpaaqiglkkgdviiganqqavkni
aelrkvldskpsvlalniqrgdstiyll

Sequence, based on observed residues (ATOM records): (download)

>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli}
qnqvdsssifnemsnkgkdqgvvvnnvktgtpaaqiglkkgdviiganqqavkniaelrk
vldskpsvlalniqrgdstiyll

SCOP Domain Coordinates for d1ky9b2:

Click to download the PDB-style file with coordinates for d1ky9b2.
(The format of our PDB-style files is described here.)

Timeline for d1ky9b2: