SCOP 1.63: Domain d1ky9b2: 1ky9 B:359-446

Lineage for d1ky9b2 (1ky9 B:359-446)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (4 families)
   peptide-binding domain

5. Family b.36.1.4: HtrA-like serine proteases [74933] (2 proteins)

6. Protein Protease Do (DegP, HtrA), C-terminal domains [74934] (1 species)
   duplication: tandem repeat of two PDZ domains

7. Species Escherichia coli [TaxId:562] [74935] (1 PDB entry)

8. Domain d1ky9b2: 1ky9 B:359-446 [73201]
   Other proteins in same PDB: d1ky9a2, d1ky9b3
   complexed with mse; mutant

Details for d1ky9b2

PDB Entry: 1ky9, 2.8 Å

PDB Description: crystal structure of degp (htra)

SCOP Domain Sequences for d1ky9b2:

Sequence, based on SEQRES records:

>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli}
qnqvdsssifngiegaemsnkgkdqgvvvnnvktgtpaaqiglkkgdviiganqqavkni
aelrkvldskpsvlalniqrgdstiyll

Sequence, based on observed residues (ATOM records):

>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli}
qnqvdsssifnemsnkgkdqgvvvnnvktgtpaaqiglkkgdviiganqqavkniaelrk
vldskpsvlalniqrgdstiyll

Timeline for d1ky9b2:

• d1ky9b2 first appeared in SCOP 1.61
  
• d1ky9b2 appears in SCOP 1.65
  
• d1ky9b2 appears in the current release, SCOPe 2.08