Lineage for d1ky7a1 (1ky7 A:701-824)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2374496Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (4 families) (S)
    contains an additional N-terminal strand
  5. 2374497Family b.1.10.1: Alpha-adaptin ear subdomain-like [49349] (2 proteins)
    ear domain consists of two different subdomains
    automatically mapped to Pfam PF02883
  6. 2374498Protein Alpha-adaptin AP2 ear domain, N-terminal subdomain [49350] (1 species)
  7. 2374499Species Mouse (Mus musculus) [TaxId:10090] [49351] (10 PDB entries)
    Uniprot P17427 694-938 # 98% sequence identity
  8. 2374509Domain d1ky7a1: 1ky7 A:701-824 [73196]
    Other proteins in same PDB: d1ky7a2, d1ky7a3
    complexed with amphiphysin fxdxf peptide (chain P)

Details for d1ky7a1

PDB Entry: 1ky7 (more details), 2.15 Å

PDB Description: the ap-2 clathrin adaptor alpha-appendage in complex with amphiphysin fxdxf
PDB Compounds: (A:) alpha-adaptin c

SCOPe Domain Sequences for d1ky7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ky7a1 b.1.10.1 (A:701-824) Alpha-adaptin AP2 ear domain, N-terminal subdomain {Mouse (Mus musculus) [TaxId: 10090]}
sednfarfvcknngvlfenqllqiglksefrqnlgrmfifygnktstqflnftptlicad
dlqtnlnlqtkpvdptvdggaqvqqvvniecisdfteapvlniqfryggtfqnvsvklpi
tlnk

SCOPe Domain Coordinates for d1ky7a1:

Click to download the PDB-style file with coordinates for d1ky7a1.
(The format of our PDB-style files is described here.)

Timeline for d1ky7a1: