Lineage for d1ky7a1 (1ky7 A:692-824)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 161622Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (2 families) (S)
  5. 161623Family b.1.10.1: Alpha-adaptin ear subdomain-like [49349] (2 proteins)
  6. 161624Protein Alpa-adaptin AP2 ear domain, N-terminal subdomain [49350] (1 species)
  7. 161625Species Mouse (Mus musculus) [TaxId:10090] [49351] (8 PDB entries)
  8. 161633Domain d1ky7a1: 1ky7 A:692-824 [73196]
    Other proteins in same PDB: d1ky7a2

Details for d1ky7a1

PDB Entry: 1ky7 (more details), 2.15 Å

PDB Description: the ap-2 clathrin adaptor alpha-appendage in complex with amphiphysin fxdxf

SCOP Domain Sequences for d1ky7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ky7a1 b.1.10.1 (A:692-824) Alpa-adaptin AP2 ear domain, N-terminal subdomain {Mouse (Mus musculus)}
gspgirlgssednfarfvcknngvlfenqllqiglksefrqnlgrmfifygnktstqfln
ftptlicaddlqtnlnlqtkpvdptvdggaqvqqvvniecisdfteapvlniqfryggtf
qnvsvklpitlnk

SCOP Domain Coordinates for d1ky7a1:

Click to download the PDB-style file with coordinates for d1ky7a1.
(The format of our PDB-style files is described here.)

Timeline for d1ky7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ky7a2