SCOPe 2.08: Domain d1kxqd1: 1kxq D:404-496

Lineage for d1kxqd1 (1kxq D:404-496)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Animal alpha-amylase [51024] (3 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [51025] (13 PDB entries)

8. Domain d1kxqd1: 1kxq D:404-496 [73169]
   Other proteins in same PDB: d1kxqa2, d1kxqb2, d1kxqc2, d1kxqd2, d1kxqe_, d1kxqf_, d1kxqg_, d1kxqh_
   complexed with ca, cl

Details for d1kxqd1

PDB Entry: 1kxq, 1.6 Å

PDB Description: camelid vhh domain in complex with porcine pancreatic alpha-amylase

PDB Compounds: (D:) alpha-amylase, pancreatic

SCOPe Domain Sequences for d1kxqd1:

Sequence; same for both SEQRES and ATOM records:

>d1kxqd1 b.71.1.1 (D:404-496) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]}
qpfanwwdngsnqvafgrgnrgfivfnnddwqlsstlqtglpggtycdvisgdkvgnsct
gikvyvssdgtaqfsisnsaedpfiaihaeskl

Timeline for d1kxqd1:

• d1kxqd1 first appeared in SCOP 1.61
  
• d1kxqd1 appears in SCOPe 2.07