Class b: All beta proteins [48724] (180 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Animal alpha-amylase [51024] (3 species) |
Species Pig (Sus scrofa) [TaxId:9823] [51025] (13 PDB entries) |
Domain d1kxqc1: 1kxq C:404-496 [73167] Other proteins in same PDB: d1kxqa2, d1kxqb2, d1kxqc2, d1kxqd2, d1kxqe_, d1kxqf_, d1kxqg_, d1kxqh_ complexed with ca, cl |
PDB Entry: 1kxq (more details), 1.6 Å
SCOPe Domain Sequences for d1kxqc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kxqc1 b.71.1.1 (C:404-496) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} qpfanwwdngsnqvafgrgnrgfivfnnddwqlsstlqtglpggtycdvisgdkvgnsct gikvyvssdgtaqfsisnsaedpfiaihaeskl
Timeline for d1kxqc1: