Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (11 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein Animal alpha-amylase [51458] (3 species) contains Ca2+-binding subdomain, residues 100-170 |
Species Pig (Sus scrofa) [TaxId:9823] [51459] (12 PDB entries) |
Domain d1kxqc2: 1kxq C:1-403 [73168] Other proteins in same PDB: d1kxqa1, d1kxqb1, d1kxqc1, d1kxqd1, d1kxqe_, d1kxqf_, d1kxqg_, d1kxqh_ |
PDB Entry: 1kxq (more details), 1.6 Å
SCOP Domain Sequences for d1kxqc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kxqc2 c.1.8.1 (C:1-403) Animal alpha-amylase {Pig (Sus scrofa)} qyapqtqsgrtsivhlfewrwvdialecerylgpkgfggvqvsppnenivvtnpsrpwwe ryqpvsyklctrsgnenefrdmvtrcnnvgvriyvdavinhmcgsgaaagtgttcgsycn pgsrefpavpysawdfndgkcktasggiesyndpyqvrdcqlvglldlalekdyvrsmia dylnklidigvagfridaskhmwpgdikavldklhnlntnwfpagsrpfifqevidlgge aiksseyfgngrvtefkygaklgtvvrkwsgekmsylknwgegwgfmpsdralvfvdnhd nqrghgaggssiltfwdarlykiavgfmlahpygftrvmssyrwarnfvngedvndwigp pnnngvikevtinadttcgndwvcehrwreirnmvwfrnvvdg
Timeline for d1kxqc2: