SCOPe 2.04: Domain d1kxpd1: 1kxp D:17-214

Lineage for d1kxpd1 (1kxp D:17-214)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (2 families)

5. Family a.126.1.1: Serum albumin-like [48553] (2 proteins)

6. Protein Vitamin D binding protein [69111] (1 species)
   domain 3 lacks the last subdomain

7. Species Human (Homo sapiens) [TaxId:9606] [69112] (6 PDB entries)

8. Domain d1kxpd1: 1kxp D:17-214 [73160]
   Other proteins in same PDB: d1kxpa1, d1kxpa2
   complexed with skeletal actin
   complexed with atp, mg

Details for d1kxpd1

PDB Entry: 1kxp, 2.1 Å

PDB Description: crystal structure of human vitamin d-binding protein in complex with skeletal actin

PDB Compounds: (D:) human vitamin d-binding protein

SCOPe Domain Sequences for d1kxpd1:

Sequence, based on SEQRES records:

>d1kxpd1 a.126.1.1 (D:17-214) Vitamin D binding protein {Human (Homo sapiens) [TaxId: 9606]}
lergrdyeknkvckefshlgkedftslslvlysrkfpsgtfeqvsqlvkevvslteacca
egadpdcydtrtsalsakscesnspfpvhpgtaecctkeglerklcmaalkhqpqefpty
veptndeiceafrkdpkeyanqfmweystnygqaplsllvsytksylsmvgscctsaspt
vcflkerlqlkhlslltt

Sequence, based on observed residues (ATOM records):

>d1kxpd1 a.126.1.1 (D:17-214) Vitamin D binding protein {Human (Homo sapiens) [TaxId: 9606]}
lergrdyeknkvckefshlgkedftslslvlysrkfpsgtfeqvsqlvkevvslteacca
egadpdcydtrtsalsakscesnspfpvhplkhqpqefptyveptndeiceafrkdpkey
anqfmweystnygqaplsllvsytksylsmvgscctsasptvcflkerlqlkhlslltt

Timeline for d1kxpd1:

• d1kxpd1 first appeared in SCOP 1.61
  
• d1kxpd1 appears in SCOPe 2.03
  
• d1kxpd1 appears in SCOPe 2.05
  
• d1kxpd1 appears in the current release, SCOPe 2.08