Lineage for d1kxpd1 (1kxp D:17-214)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2730252Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2730253Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2730254Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 2730668Protein Vitamin D binding protein [69111] (1 species)
    domain 3 lacks the last subdomain
  7. 2730669Species Human (Homo sapiens) [TaxId:9606] [69112] (6 PDB entries)
  8. 2730670Domain d1kxpd1: 1kxp D:17-214 [73160]
    Other proteins in same PDB: d1kxpa1, d1kxpa2
    complexed with skeletal actin
    complexed with atp, mg

Details for d1kxpd1

PDB Entry: 1kxp (more details), 2.1 Å

PDB Description: crystal structure of human vitamin d-binding protein in complex with skeletal actin
PDB Compounds: (D:) human vitamin d-binding protein

SCOPe Domain Sequences for d1kxpd1:

Sequence, based on SEQRES records: (download)

>d1kxpd1 a.126.1.1 (D:17-214) Vitamin D binding protein {Human (Homo sapiens) [TaxId: 9606]}
lergrdyeknkvckefshlgkedftslslvlysrkfpsgtfeqvsqlvkevvslteacca
egadpdcydtrtsalsakscesnspfpvhpgtaecctkeglerklcmaalkhqpqefpty
veptndeiceafrkdpkeyanqfmweystnygqaplsllvsytksylsmvgscctsaspt
vcflkerlqlkhlslltt

Sequence, based on observed residues (ATOM records): (download)

>d1kxpd1 a.126.1.1 (D:17-214) Vitamin D binding protein {Human (Homo sapiens) [TaxId: 9606]}
lergrdyeknkvckefshlgkedftslslvlysrkfpsgtfeqvsqlvkevvslteacca
egadpdcydtrtsalsakscesnspfpvhplkhqpqefptyveptndeiceafrkdpkey
anqfmweystnygqaplsllvsytksylsmvgscctsasptvcflkerlqlkhlslltt

SCOPe Domain Coordinates for d1kxpd1:

Click to download the PDB-style file with coordinates for d1kxpd1.
(The format of our PDB-style files is described here.)

Timeline for d1kxpd1: