|  | Class d: Alpha and beta proteins (a+b) [53931] (224 folds) | 
|  | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold | 
|  | Superfamily d.169.1: C-type lectin-like [56436] (6 families)  | 
|  | Family d.169.1.1: C-type lectin domain [56437] (18 proteins) | 
|  | Protein Mannose-binding protein A, lectin domain [56458] (2 species) | 
|  | Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries) | 
|  | Domain d1kx1d1: 1kx1 D:105-221 [73139] Other proteins in same PDB: d1kx1a2, d1kx1b2, d1kx1c2, d1kx1d2, d1kx1e2, d1kx1f2 | 
PDB Entry: 1kx1 (more details), 2.8 Å
SCOP Domain Sequences for d1kx1d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kx1d1 d.169.1.1 (D:105-221) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqashtavcefpa
Timeline for d1kx1d1: