Lineage for d1kwzb1 (1kwz B:105-221)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 264459Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 264460Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 264461Family d.169.1.1: C-type lectin domain [56437] (18 proteins)
  6. 264527Protein Mannose-binding protein A, lectin domain [56458] (2 species)
  7. 264530Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)
  8. 264590Domain d1kwzb1: 1kwz B:105-221 [73123]
    Other proteins in same PDB: d1kwza2, d1kwzb2, d1kwzc2

Details for d1kwzb1

PDB Entry: 1kwz (more details), 1.9 Å

PDB Description: rat mannose protein a (h189v) complexed with man-a13-man

SCOP Domain Sequences for d1kwzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kwzb1 d.169.1.1 (B:105-221) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdepndvgsgedcvtivdnglwndiscqashtavcefpa

SCOP Domain Coordinates for d1kwzb1:

Click to download the PDB-style file with coordinates for d1kwzb1.
(The format of our PDB-style files is described here.)

Timeline for d1kwzb1: