Lineage for d1kw2b3 (1kw2 B:405-474)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1098092Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 1098093Superfamily a.126.1: Serum albumin-like [48552] (1 family) (S)
  5. 1098094Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 1098255Protein Vitamin D binding protein [69111] (1 species)
    domain 3 lacks the last subdomain
  7. 1098256Species Human (Homo sapiens) [TaxId:9606] [69112] (6 PDB entries)
  8. 1098265Domain d1kw2b3: 1kw2 B:405-474 [73076]

Details for d1kw2b3

PDB Entry: 1kw2 (more details), 2.15 Å

PDB Description: crystal structure of uncomplexed vitamin d-binding protein
PDB Compounds: (B:) Vitamin D-binding protein

SCOPe Domain Sequences for d1kw2b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kw2b3 a.126.1.1 (B:405-474) Vitamin D binding protein {Human (Homo sapiens) [TaxId: 9606]}
elcadysentfteykkklaerlkaklpdatpkelaklvnkrsdfasnccsinspplycds
eidaelknil

SCOPe Domain Coordinates for d1kw2b3:

Click to download the PDB-style file with coordinates for d1kw2b3.
(The format of our PDB-style files is described here.)

Timeline for d1kw2b3: