![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains |
![]() | Superfamily a.126.1: Serum albumin-like [48552] (1 family) ![]() |
![]() | Family a.126.1.1: Serum albumin-like [48553] (2 proteins) |
![]() | Protein Vitamin D binding protein [69111] (1 species) domain 3 lacks the last subdomain |
![]() | Species Human (Homo sapiens) [TaxId:9606] [69112] (6 PDB entries) |
![]() | Domain d1kw2a2: 1kw2 A:215-404 [73072] |
PDB Entry: 1kw2 (more details), 2.15 Å
SCOPe Domain Sequences for d1kw2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kw2a2 a.126.1.1 (A:215-404) Vitamin D binding protein {Human (Homo sapiens) [TaxId: 9606]} lsnrvcsqyaaygekksrlsnliklaqkvptadledvlplaeditnilskccesasedcm akelpehtvklcdnlstknskfedccqektamdvfvctyfmpaaqlpelpdvelptnkdv cdpgntkvmdkytfelsrrthlpevflskvleptlkslgeccdvedsttcfnakgpllkk elssfidkgq
Timeline for d1kw2a2: