Lineage for d1kuxa_ (1kux A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2209196Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2209197Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2209198Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2209524Protein Serotonin N-acetyltranferase [55746] (1 species)
  7. 2209525Species Sheep (Ovis aries) [TaxId:9940] [55747] (7 PDB entries)
  8. 2209527Domain d1kuxa_: 1kux A: [73021]
    complexed with ca3

Details for d1kuxa_

PDB Entry: 1kux (more details), 1.8 Å

PDB Description: X-ray Crystallographic Studies of Serotonin N-acetyltransferase Catalysis and Inhibition
PDB Compounds: (A:) serotonin n-acetyltransferase

SCOPe Domain Sequences for d1kuxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kuxa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]}
htlpanefrcltpedaagvfeiereafisvsgncplnldevqhfltlcpelslgwfvegr
lvafiigslwdeerltqeslalhrprghsahlhalavhrsfrqqgkgsvllwrylhhvga
qpavrravlmcedalvpfyqrfgfhpagpcaivvgsltftemhcsl

SCOPe Domain Coordinates for d1kuxa_:

Click to download the PDB-style file with coordinates for d1kuxa_.
(The format of our PDB-style files is described here.)

Timeline for d1kuxa_: