Lineage for d1kq1n_ (1kq1 N:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 228326Fold b.38: Sm-like fold [50181] (2 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 228327Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (3 families) (S)
  5. 228500Family b.38.1.2: Pleiotropic translational regulator Hfq [74939] (1 protein)
    forms homohexameric ring structures
  6. 228501Protein Pleiotropic translational regulator Hfq [74940] (1 species)
  7. 228502Species Staphylococcus aureus [TaxId:1280] [74941] (2 PDB entries)
  8. 228509Domain d1kq1n_: 1kq1 N: [72854]

Details for d1kq1n_

PDB Entry: 1kq1 (more details), 1.55 Å

PDB Description: 1.55 A Crystal structure of the pleiotropic translational regulator, Hfq

SCOP Domain Sequences for d1kq1n_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kq1n_ b.38.1.2 (N:) Pleiotropic translational regulator Hfq {Staphylococcus aureus}
niqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhaistytv
e

SCOP Domain Coordinates for d1kq1n_:

Click to download the PDB-style file with coordinates for d1kq1n_.
(The format of our PDB-style files is described here.)

Timeline for d1kq1n_: