Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins) |
Protein Glycinamide ribonucleotide transformylase PurT, N-domain [52448] (1 species) |
Species Escherichia coli [TaxId:562] [52449] (7 PDB entries) |
Domain d1kjia2: 1kji A:2-112 [72602] Other proteins in same PDB: d1kjia1, d1kjia3, d1kjib1, d1kjib3 complexed with acp, cl, edo, mg, mpo, na |
PDB Entry: 1kji (more details), 1.6 Å
SCOPe Domain Sequences for d1kjia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kjia2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltm
Timeline for d1kjia2: