Lineage for d1kjia2 (1kji A:2-112)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470135Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2470136Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2470137Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)
  6. 2470287Protein Glycinamide ribonucleotide transformylase PurT, N-domain [52448] (1 species)
  7. 2470288Species Escherichia coli [TaxId:562] [52449] (7 PDB entries)
  8. 2470295Domain d1kjia2: 1kji A:2-112 [72602]
    Other proteins in same PDB: d1kjia1, d1kjia3, d1kjib1, d1kjib3
    complexed with acp, cl, edo, mg, mpo, na

Details for d1kjia2

PDB Entry: 1kji (more details), 1.6 Å

PDB Description: crystal structure of glycinamide ribonucleotide transformylase in complex with mg-amppcp
PDB Compounds: (A:) phosphoribosylglycinamide formyltransferase 2

SCOPe Domain Sequences for d1kjia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kjia2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]}
tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm
ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltm

SCOPe Domain Coordinates for d1kjia2:

Click to download the PDB-style file with coordinates for d1kjia2.
(The format of our PDB-style files is described here.)

Timeline for d1kjia2: