SCOPe 2.07: Domain d1kjib2: 1kji B:2-112

Lineage for d1kjib2 (1kji B:2-112)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)

6. Protein Glycinamide ribonucleotide transformylase PurT, N-domain [52448] (1 species)

7. Species Escherichia coli [TaxId:562] [52449] (7 PDB entries)

8. Domain d1kjib2: 1kji B:2-112 [72605]
   Other proteins in same PDB: d1kjia1, d1kjia3, d1kjib1, d1kjib3
   complexed with acp, cl, edo, mg, mpo, na

Details for d1kjib2

PDB Entry: 1kji, 1.6 Å

PDB Description: crystal structure of glycinamide ribonucleotide transformylase in complex with mg-amppcp

PDB Compounds: (B:) phosphoribosylglycinamide formyltransferase 2

SCOPe Domain Sequences for d1kjib2:

Sequence; same for both SEQRES and ATOM records:

>d1kjib2 c.30.1.1 (B:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]}
tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm
ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltm

Timeline for d1kjib2:

• d1kjib2 first appeared in SCOP 1.61
  
• d1kjib2 appears in SCOPe 2.06
  
• d1kjib2 appears in the current release, SCOPe 2.08