Lineage for d1kiui2 (1kiu I:122-205)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 224988Fold b.7: C2 domain-like [49561] (4 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 225058Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (1 family) (S)
  5. 225059Family b.7.2.1: Periplasmic chaperone C-domain [49585] (3 proteins)
  6. 225060Protein FimC [49588] (1 species)
  7. 225061Species Escherichia coli [TaxId:562] [49589] (4 PDB entries)
  8. 225082Domain d1kiui2: 1kiu I:122-205 [72540]
    Other proteins in same PDB: d1kiua1, d1kiub1, d1kiub2, d1kiuc1, d1kiud1, d1kiud2, d1kiue1, d1kiuf1, d1kiuf2, d1kiug1, d1kiuh1, d1kiuh2, d1kiui1, d1kiuj1, d1kiuj2, d1kiuk1, d1kiul1, d1kiul2, d1kium1, d1kiun1, d1kiun2, d1kiuo1, d1kiup1, d1kiup2

Details for d1kiui2

PDB Entry: 1kiu (more details), 3 Å

PDB Description: fimh adhesin q133n mutant-fimc chaperone complex with methyl-alpha-d- mannose

SCOP Domain Sequences for d1kiui2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kiui2 b.7.2.1 (I:122-205) FimC {Escherichia coli}
lppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsda
gsnityrtindygaltpkmtgvme

SCOP Domain Coordinates for d1kiui2:

Click to download the PDB-style file with coordinates for d1kiui2.
(The format of our PDB-style files is described here.)

Timeline for d1kiui2:

225082
d1kiui2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1kiui1