| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.1: Parallel coiled-coil [57943] (38 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.15: SNARE fusion complex [58038] (2 families) ![]() tetrameric parallel coiled coil |
| Family h.1.15.1: SNARE fusion complex [58039] (12 proteins) |
| Protein Complexin [88921] (1 species) |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [88922] (1 PDB entry) |
| Domain d1kile_: 1kil E: [72522] Other proteins in same PDB: d1kila_, d1kilb_, d1kilc_, d1kild_ complex with SNAP25, synaptobrevin and syntaxin fragments complexed with mg |
PDB Entry: 1kil (more details), 2.3 Å
SCOPe Domain Sequences for d1kile_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kile_ h.1.15.1 (E:) Complexin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kkeeerqealrqaeeerkakyakmeaerevmrqgirdkygi
Timeline for d1kile_:
View in 3DDomains from other chains: (mouse over for more information) d1kila_, d1kilb_, d1kilc_, d1kild_ |