Lineage for d1kena_ (1ken A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 555254Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 555255Superfamily b.19.1: Viral protein domain [49818] (3 families) (S)
    forms homotrimers
  5. 555300Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (1 protein)
  6. 555301Protein Hemagglutinin [49824] (1 species)
    includes rudiment esterase domain
  7. 555302Species Influenza A virus, different strains [TaxId:11320] [49825] (36 PDB entries)
  8. 555391Domain d1kena_: 1ken A: [72373]
    Other proteins in same PDB: d1kenb_, d1kend_, d1kenf_, d1kenh1, d1kenh2, d1kenl1, d1kenl2, d1kent1, d1kent2, d1kenu1, d1kenu2

Details for d1kena_

PDB Entry: 1ken (more details), 3.5 Å

PDB Description: influenza virus hemagglutinin complexed with an antibody that prevents the hemagglutinin low ph fusogenic transition

SCOP Domain Sequences for d1kena_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kena_ b.19.1.2 (A:) Hemagglutinin {Influenza A virus, different strains}
statlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlid
allgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwt
gvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgihhpstn
qeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsn
gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
vkqntlklatgmrnvpekqt

SCOP Domain Coordinates for d1kena_:

Click to download the PDB-style file with coordinates for d1kena_.
(The format of our PDB-style files is described here.)

Timeline for d1kena_: