SCOP 1.71: Domain d1kenl1: 1ken L:1-108

Lineage for d1kenl1 (1ken L:1-108)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88527] (12 PDB entries)

8. Domain d1kenl1: 1ken L:1-108 [72381]
   Other proteins in same PDB: d1kena_, d1kenb_, d1kenc_, d1kend_, d1kene_, d1kenf_, d1kenh1, d1kenh2, d1kenl2, d1kent1, d1kent2, d1kenu2

Details for d1kenl1

PDB Entry: 1ken, 3.5 Å

PDB Description: influenza virus hemagglutinin complexed with an antibody that prevents the hemagglutinin low ph fusogenic transition

SCOP Domain Sequences for d1kenl1:

Sequence; same for both SEQRES and ATOM records:

>d1kenl1 b.1.1.1 (L:1-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.1}
qivltqspaimsaspgekvtltcsasstitssflywyqqkpgsspklwiystsnlasgvp
arfsgsgsgtsysltissleaedgasyfchqwetfprtfgggtkleik

Timeline for d1kenl1:

• d1kenl1 first appeared in SCOP 1.61
  
• d1kenl1 appears in SCOP 1.69
  
• d1kenl1 appears in SCOP 1.73
  
• d1kenl1 appears in the current release, SCOPe 2.08