Lineage for d1kenu1 (1ken U:1-108)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 547289Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 547687Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88527] (12 PDB entries)
  8. 547703Domain d1kenu1: 1ken U:1-108 [72385]
    Other proteins in same PDB: d1kena_, d1kenb_, d1kenc_, d1kend_, d1kene_, d1kenf_, d1kenh1, d1kenh2, d1kenl2, d1kent1, d1kent2, d1kenu2
    part of Fab against influenza virus hemagglutinin
    complexed with man, nag

Details for d1kenu1

PDB Entry: 1ken (more details), 3.5 Å

PDB Description: influenza virus hemagglutinin complexed with an antibody that prevents the hemagglutinin low ph fusogenic transition

SCOP Domain Sequences for d1kenu1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kenu1 b.1.1.1 (U:1-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.1}
qivltqspaimsaspgekvtltcsasstitssflywyqqkpgsspklwiystsnlasgvp
arfsgsgsgtsysltissleaedgasyfchqwetfprtfgggtkleik

SCOP Domain Coordinates for d1kenu1:

Click to download the PDB-style file with coordinates for d1kenu1.
(The format of our PDB-style files is described here.)

Timeline for d1kenu1: