SCOPe 2.01: Domain d1k7eb_: 1k7e B:

Lineage for d1k7eb_ (1k7e B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families)

5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)

6. Protein Tryptophan synthase, beta-subunit [53688] (2 species)

7. Species Salmonella typhimurium [TaxId:90371] [53689] (37 PDB entries)

8. Domain d1k7eb_: 1k7e B: [72098]
   Other proteins in same PDB: d1k7ea_
   complexed with iag, na, plp

Details for d1k7eb_

PDB Entry: 1k7e, 2.3 Å

PDB Description: crystal structure of wild-type tryptophan synthase complexed with n-[1h-indol-3-yl-acetyl]glycine acid

PDB Compounds: (B:) tryptophan synthase beta chain

SCOPe Domain Sequences for d1k7eb_:

Sequence; same for both SEQRES and ATOM records:

>d1k7eb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]}
ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal
asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
mreqpekeqllvvnlsgrgdkdiftvhdilkar

Timeline for d1k7eb_:

• d1k7eb_ first appeared in SCOP 1.61
  
• d1k7eb_ appears in SCOP 1.75
  
• d1k7eb_ appears in SCOPe 2.02
  
• d1k7eb_ appears in the current release, SCOPe 2.08