Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) |
Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (8 proteins) |
Protein Tryptophan synthase, beta-subunit [53688] (2 species) |
Species Salmonella typhimurium [TaxId:90371] [53689] (47 PDB entries) |
Domain d1k7eb_: 1k7e B: [72098] Other proteins in same PDB: d1k7ea_ complexed with iag, na, plp |
PDB Entry: 1k7e (more details), 2.3 Å
SCOP Domain Sequences for d1k7eb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k7eb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]} ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm mreqpekeqllvvnlsgrgdkdiftvhdilkar
Timeline for d1k7eb_: