Lineage for d1k47f2 (1k47 F:195-329)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 257061Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 257962Superfamily d.58.26: GHMP Kinase [55060] (4 families) (S)
    common fold is elaborated with additional secondary structures
  5. 257990Family d.58.26.4: Phosphomevalonate kinase (PMK) [75454] (1 protein)
  6. 257991Protein Phosphomevalonate kinase (PMK) [75455] (1 species)
  7. 257992Species Streptococcus pneumoniae r6 [TaxId:171101] [75456] (1 PDB entry)
  8. 257998Domain d1k47f2: 1k47 F:195-329 [72051]
    Other proteins in same PDB: d1k47a1, d1k47b1, d1k47c1, d1k47d1, d1k47e1, d1k47f1
    complexed with mse

Details for d1k47f2

PDB Entry: 1k47 (more details), 2.42 Å

PDB Description: crystal structure of the streptococcus pneumoniae phosphomevalonate kinase (pmk)

SCOP Domain Sequences for d1k47f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k47f2 d.58.26.4 (F:195-329) Phosphomevalonate kinase (PMK) {Streptococcus pneumoniae r6}
kptlecdflvgwtkevavsshmvqqikqninqnfltssketvvslvealeqgksekiieq
vevasklleglstdiytpllrqlkeasqdlqavakssgagggdcgialsfdaqstktlkn
rwadlgiellyqeri

SCOP Domain Coordinates for d1k47f2:

Click to download the PDB-style file with coordinates for d1k47f2.
(The format of our PDB-style files is described here.)

Timeline for d1k47f2: