Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.58: Ferredoxin-like [54861] (44 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.26: GHMP Kinase [55060] (4 families) common fold is elaborated with additional secondary structures |
Family d.58.26.4: Phosphomevalonate kinase (PMK) [75454] (1 protein) |
Protein Phosphomevalonate kinase (PMK) [75455] (1 species) |
Species Streptococcus pneumoniae r6 [TaxId:171101] [75456] (1 PDB entry) |
Domain d1k47f2: 1k47 F:195-329 [72051] Other proteins in same PDB: d1k47a1, d1k47b1, d1k47c1, d1k47d1, d1k47e1, d1k47f1 complexed with mse |
PDB Entry: 1k47 (more details), 2.42 Å
SCOP Domain Sequences for d1k47f2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k47f2 d.58.26.4 (F:195-329) Phosphomevalonate kinase (PMK) {Streptococcus pneumoniae r6} kptlecdflvgwtkevavsshmvqqikqninqnfltssketvvslvealeqgksekiieq vevasklleglstdiytpllrqlkeasqdlqavakssgagggdcgialsfdaqstktlkn rwadlgiellyqeri
Timeline for d1k47f2: