SCOPe 2.02: Domain d1k3ua_: 1k3u A:

Lineage for d1k3ua_ (1k3u A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins)

6. Protein Trp synthase alpha-subunit [51388] (5 species)

7. Species Salmonella typhimurium [TaxId:90371] [51389] (39 PDB entries)

8. Domain d1k3ua_: 1k3u A: [72030]
   Other proteins in same PDB: d1k3ub_
   complexed with iad, na, plp

Details for d1k3ua_

PDB Entry: 1k3u, 1.7 Å

PDB Description: crystal structure of wild-type tryptophan synthase complexed with n- [1h-indol-3-yl-acetyl]aspartic acid

PDB Compounds: (A:) tryptophan synthase alpha chain

SCOPe Domain Sequences for d1k3ua_:

Sequence; same for both SEQRES and ATOM records:

>d1k3ua_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]}
meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplad
gptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceq
vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrs
gvtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivki
ieknlaspkqmlaelrsfvsamkaasra

Timeline for d1k3ua_:

• d1k3ua_ first appeared in SCOP 1.61
  
• d1k3ua_ appears in SCOPe 2.01
  
• d1k3ua_ appears in SCOPe 2.03
  
• d1k3ua_ appears in the current release, SCOPe 2.08