Lineage for d1k3ua_ (1k3u A:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies) 
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families) 
Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (3 proteins) Protein Trp synthase alpha-subunit [51388] (2 species) Species Salmonella typhimurium [TaxId:90371] [51389] (27 PDB entries) 
Domain d1k3ua_: 1k3u A: [72030]
Other proteins in same PDB: d1k3ub_
Details for d1k3ua_
PDB Entry: 1k3u (more details), 1.7 Å
PDB Description: crystal structure of wild-type tryptophan synthase complexed with n- [1h-indol-3-yl-acetyl]aspartic acid
SCOP Domain Sequences for d1k3ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k3ua_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium}
meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplad
gptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceq
vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrs
gvtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivki
ieknlaspkqmlaelrsfvsamkaasra
SCOP Domain Coordinates for d1k3ua_:
Click to download the PDB-style file with coordinates for d1k3ua_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1k3ua_:
- d1k3ua_ is new in SCOP 1.61
- d1k3ua_ appears in SCOP 1.63
- d1k3ua_ appears in the current release, SCOPe 2.08
View in 3D
